Lineage for d1ffkr_ (1ffk R:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705409Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
    automatically mapped to Pfam PF01246
  6. 1705410Protein Ribosomal protein L24e [57750] (1 species)
  7. 1705411Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. Domain d1ffkr_: 1ffk R: [45152]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    complexed with cd, k, mg

Details for d1ffkr_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (R:) ribosomal protein l24e

SCOPe Domain Sequences for d1ffkr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkr_ g.39.1.6 (R:) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d1ffkr_:

Click to download the PDB-style file with coordinates for d1ffkr_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkr_: