Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) many known members contain KOW motif |
Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
Protein Ribosomal proteins L21e [50108] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries) |
Domain d1ffkn_: 1ffk N: [24606] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffkn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffkn_ b.34.5.1 (N:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui [TaxId: 2238]} pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt gtvegkqgdaykvdivdggkektiivtaahlrrqe
Timeline for d1ffkn_:
View in 3D Domains from other chains: (mouse over for more information) d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ |