Lineage for d1feha3 (1feh A:127-209)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906422Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1906505Protein Fe-only hydrogenase, second domain [54885] (1 species)
  7. 1906506Species Clostridium pasteurianum [TaxId:1501] [54886] (4 PDB entries)
  8. 1906508Domain d1feha3: 1feh A:127-209 [38998]
    Other proteins in same PDB: d1feha1, d1feha2
    complexed with fes, hc1, sf4

Details for d1feha3

PDB Entry: 1feh (more details), 1.8 Å

PDB Description: fe-only hydrogenase from clostridium pasteurianum
PDB Compounds: (A:) protein (periplasmic hydrogenase 1)

SCOPe Domain Sequences for d1feha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feha3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOPe Domain Coordinates for d1feha3:

Click to download the PDB-style file with coordinates for d1feha3.
(The format of our PDB-style files is described here.)

Timeline for d1feha3: