Lineage for d1fe0b_ (1fe0 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) 
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species) 
Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (17 PDB entries)
Uniprot O00244
Domain d1fe0b_: 1fe0 B: [39346]
complexed with cd, so4
Details for d1fe0b_
PDB Entry: 1fe0 (more details), 1.75 Å
PDB Description: crystal structure of cadmium-hah1
PDB Compounds: (B:) copper transport protein atox1SCOPe Domain Sequences for d1fe0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe0b_ d.58.17.1 (B:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle
SCOPe Domain Coordinates for d1fe0b_:
Click to download the PDB-style file with coordinates for d1fe0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fe0b_:
- d1fe0b_ first appeared (with stable ids) in SCOP 1.55
- d1fe0b_ appears in SCOPe 2.07
View in 3D
