Lineage for d1fcha_ (1fch A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096244Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1096245Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1096296Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species)
  7. 1096297Species Human (Homo sapiens) [TaxId:9606] [48463] (1 PDB entry)
  8. 1096298Domain d1fcha_: 1fch A: [19212]
    complexed with the pts1 peptide

Details for d1fcha_

PDB Entry: 1fch (more details), 2.2 Å

PDB Description: crystal structure of the pts1 complexed to the tpr region of human pex5
PDB Compounds: (A:) peroxisomal targeting signal 1 receptor

SCOPe Domain Sequences for d1fcha_:

Sequence, based on SEQRES records: (download)

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}
satydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylg
ttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpay
ahlvtpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgv
lfnlsgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyi
rsrynlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgq
sdaygaadardlstlltmfglpq

Sequence, based on observed residues (ATOM records): (download)

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}
satydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylg
ttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpay
ahlvtrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcf
taalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlga
hreavehflealnmqrksggamseniwstlrlalsmlgqsdaygaadardlstlltmfgl
pq

SCOPe Domain Coordinates for d1fcha_:

Click to download the PDB-style file with coordinates for d1fcha_.
(The format of our PDB-style files is described here.)

Timeline for d1fcha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fchb_