Lineage for d1fc4a_ (1fc4 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
formerly omega-Aminoacid:pyruvate aminotransferase-like
Protein 2-amino-3-ketobutyrate CoA ligase [64128] (1 species) Species Escherichia coli [TaxId:562] [64129] (1 PDB entry) 
Domain d1fc4a_: 1fc4 A: [59760]
complexed with akb
Details for d1fc4a_
PDB Entry: 1fc4 (more details), 2 Å
PDB Description: 2-amino-3-ketobutyrate coa ligase
PDB Compounds: (A:) 2-amino-3-ketobutyrate conenzyme a ligaseSCOPe Domain Sequences for d1fc4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]}
gshmrgefyqqltndletaraeglfkeeriitsaqqaditvadgshvinfcannylglan
hpdliaaakagmdshgfgmasvrficgtqdshkeleqklaaflgmedailysscfdangg
lfetllgaedaiisdalnhasiidgvrlckakryryanndmqelearlkeareagarhvl
iatdgvfsmdgvianlkgvcdladkydalvmvddshavgfvgengrgsheycdvmgrvdi
itgtlgkalggasggytaarkevvewlrqrsrpylfsnslapaivaasikvlemveagse
lrdrlwanarqfreqmsaagftlagadhaiipvmlgdavvaqkfarelqkegiyvtgffy
pvvpkgqarirtqmsaahtpeqitraveaftrigkqlgvia
SCOPe Domain Coordinates for d1fc4a_:
Click to download the PDB-style file with coordinates for d1fc4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fc4a_:
- d1fc4a_ first appeared in SCOP 1.57
- d1fc4a_ appears in SCOPe 2.04
- d1fc4a_ is called d1fc4a1 in SCOPe 2.06
- d1fc4a_ appears in the current release, SCOPe 2.08, called d1fc4a1
View in 3D
