Lineage for d1fbva3 (1fbv A:264-355)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.93: SH2-like [55549] (1 superfamily)
3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helicesSuperfamily d.93.1: SH2 domain [55550] (2 families) 
Family d.93.1.1: SH2 domain [55551] (35 proteins)
Pfam PF00017
Protein Cbl [55587] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55588] (12 PDB entries) 
Domain d1fbva3: 1fbv A:264-355 [40532]
Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva4, d1fbvc_
complexed with so4, zn
Details for d1fbva3
PDB Entry: 1fbv (more details), 2.9 Å
PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases
PDB Compounds: (A:) signal transduction protein cblSCOPe Domain Sequences for d1fbva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbva3 d.93.1.1 (A:264-355) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltglcep
SCOPe Domain Coordinates for d1fbva3:
Click to download the PDB-style file with coordinates for d1fbva3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fbva3:
- d1fbva3 first appeared (with stable ids) in SCOP 1.55
- d1fbva3 appears in SCOPe 2.07
View in 3D
