| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein Cbl [55587] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55588] (12 PDB entries) |
| Domain d1fbva3: 1fbv A:264-355 [40532] Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva4, d1fbvc_ complexed with so4, zn |
PDB Entry: 1fbv (more details), 2.9 Å
SCOPe Domain Sequences for d1fbva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbva3 d.93.1.1 (A:264-355) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltglcep
Timeline for d1fbva3: