Lineage for d1fbla2 (1fbl A:100-271)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) 
Protein Fibroblast collagenase (MMP-1) [55529] (2 species) 
Species Pig (Sus scrofa) [TaxId:9823] [55531] (1 PDB entry) 
Domain d1fbla2: 1fbl A:100-271 [40347]
Other proteins in same PDB: d1fbla1
complexed with ca, hta, zn
Details for d1fbla2
PDB Entry: 1fbl (more details), 2.5 Å
PDB Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller
PDB Compounds: (A:) fibroblast (interstitial) collagenase (mmp-1)SCOPe Domain Sequences for d1fbla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbla2 d.92.1.11 (A:100-271) Fibroblast collagenase (MMP-1) {Pig (Sus scrofa) [TaxId: 9823]}
fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi
misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe
lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpsg
SCOPe Domain Coordinates for d1fbla2:
Click to download the PDB-style file with coordinates for d1fbla2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fbla2:
- d1fbla2 first appeared (with stable ids) in SCOP 1.55, called d1fbl_2
- d1fbla2 appears in SCOPe 2.04
- d1fbla2 appears in SCOPe 2.06
- d1fbla2 appears in the current release, SCOPe 2.08
View in 3D
