Lineage for d1faxa_ (1fax A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Coagulation factor Xa, protease domain [50574] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50575] (58 PDB entries)
    Uniprot P00742 235-467
  8. Domain d1faxa_: 1fax A: [26345]
    Other proteins in same PDB: d1faxl_
    complexed with ca, dx9

Details for d1faxa_

PDB Entry: 1fax (more details), 3 Å

PDB Description: coagulation factor xa inhibitor complex
PDB Compounds: (A:) factor xa

SCOPe Domain Sequences for d1faxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faxa_ b.47.1.2 (A:) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnta
aeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktr

SCOPe Domain Coordinates for d1faxa_ are not available.

Timeline for d1faxa_:

Domains from other chains:
(mouse over for more information)
d1faxl_