Lineage for d1fawb_ (1faw B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687101Species Graylag goose (Anser anser) [TaxId:8843] [68940] (1 PDB entry)
  8. 2687102Domain d1fawb_: 1faw B: [65003]
    Other proteins in same PDB: d1fawa_, d1fawc_
    complexed with hem, oxy

Details for d1fawb_

PDB Entry: 1faw (more details), 3.09 Å

PDB Description: graylag goose hemoglobin (oxy form)
PDB Compounds: (B:) hemoglobin (beta subunit)

SCOPe Domain Sequences for d1fawb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fawb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Graylag goose (Anser anser) [TaxId: 8843]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpecqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d1fawb_:

Click to download the PDB-style file with coordinates for d1fawb_.
(The format of our PDB-style files is described here.)

Timeline for d1fawb_: