Lineage for d1fawa_ (1faw A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299707Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2299806Species Graylag goose (Anser anser) [TaxId:8843] [68938] (1 PDB entry)
  8. 2299807Domain d1fawa_: 1faw A: [65002]
    Other proteins in same PDB: d1fawb_, d1fawd_
    complexed with hem, oxy

Details for d1fawa_

PDB Entry: 1faw (more details), 3.09 Å

PDB Description: graylag goose hemoglobin (oxy form)
PDB Compounds: (A:) hemoglobin (alpha subunit)

SCOPe Domain Sequences for d1fawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fawa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Graylag goose (Anser anser) [TaxId: 8843]}
vlsaadktnvkgvfskigghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvaaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltpe
vhasldkflcavgtvltakyr

SCOPe Domain Coordinates for d1fawa_:

Click to download the PDB-style file with coordinates for d1fawa_.
(The format of our PDB-style files is described here.)

Timeline for d1fawa_: