| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (24 species) |
| Species Graylag goose (Anser anser) [TaxId:8843] [68938] (1 PDB entry) |
| Domain d1fawa_: 1faw A: [65002] Other proteins in same PDB: d1fawb_, d1fawd_ complexed with hem, oxy |
PDB Entry: 1faw (more details), 3.09 Å
SCOPe Domain Sequences for d1fawa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fawa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Graylag goose (Anser anser) [TaxId: 8843]}
vlsaadktnvkgvfskigghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvaaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltpe
vhasldkflcavgtvltakyr
Timeline for d1fawa_: