Lineage for d1fapb_ (1fap B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) 
automatically mapped to Pfam PF08771Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins) 
Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47215] (7 PDB entries) 
Domain d1fapb_: 1fap B: [16618]
Other proteins in same PDB: d1fapa_
complexed with rap
Details for d1fapb_
PDB Entry: 1fap (more details), 2.7 Å
PDB Description: the structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
PDB Compounds: (B:) frapSCOPe Domain Sequences for d1fapb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fapb_ a.24.7.1 (B:) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens) [TaxId: 9606]}
rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd
lmeaqewcrkymksgnvkdltqawdlyyhvfrris
SCOPe Domain Coordinates for d1fapb_:
Click to download the PDB-style file with coordinates for d1fapb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fapb_:
- d1fapb_ first appeared (with stable ids) in SCOP 1.55
- d1fapb_ appears in SCOPe 2.04
- d1fapb_ appears in SCOPe 2.06
- d1fapb_ appears in the current release, SCOPe 2.08
View in 3D
