Class a: All alpha proteins [46456] (286 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) automatically mapped to Pfam PF08771 |
Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins) |
Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47215] (7 PDB entries) |
Domain d1fapb_: 1fap B: [16618] Other proteins in same PDB: d1fapa_ complexed with rap |
PDB Entry: 1fap (more details), 2.7 Å
SCOPe Domain Sequences for d1fapb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fapb_ a.24.7.1 (B:) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens) [TaxId: 9606]} rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd lmeaqewcrkymksgnvkdltqawdlyyhvfrris
Timeline for d1fapb_: