Lineage for d1fa4a_ (1fa4 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791147Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 791385Protein Plastocyanin [49507] (14 species)
  7. 791386Species Anabaena variabilis [TaxId:1172] [49517] (5 PDB entries)
  8. 791393Domain d1fa4a_: 1fa4 A: [22867]
    complexed with cu

Details for d1fa4a_

PDB Entry: 1fa4 (more details)

PDB Description: elucidation of the paramagnetic relaxation of heteronuclei and protons in cu(ii) plastocyanin from anabaena variabilis
PDB Compounds: (A:) plastocyanin

SCOP Domain Sequences for d1fa4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fa4a_ b.6.1.1 (A:) Plastocyanin {Anabaena variabilis [TaxId: 1172]}
etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
hkqllmspgqststtfpadapageytfycephrgagmvgkitvag

SCOP Domain Coordinates for d1fa4a_:

Click to download the PDB-style file with coordinates for d1fa4a_.
(The format of our PDB-style files is described here.)

Timeline for d1fa4a_: