Lineage for d1fa0b1 (1fa0 B:352-526)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560667Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2560668Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
    automatically mapped to Pfam PF04926
  6. 2560669Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 2560670Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries)
  8. 2560676Domain d1fa0b1: 1fa0 B:352-526 [39336]
    Other proteins in same PDB: d1fa0a3, d1fa0a4, d1fa0b3, d1fa0b4, d1fa0b5
    complexed with 3ad, 3at, mn, pop

Details for d1fa0b1

PDB Entry: 1fa0 (more details), 2.6 Å

PDB Description: structure of yeast poly(a) polymerase bound to manganate and 3'-datp
PDB Compounds: (B:) poly(a)-polymerase

SCOPe Domain Sequences for d1fa0b1:

Sequence, based on SEQRES records: (download)

>d1fa0b1 d.58.16.1 (B:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdene

Sequence, based on observed residues (ATOM records): (download)

>d1fa0b1 d.58.16.1 (B:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtpkaylstmyigldfnivdihipctefv
nlcrsfnedygdhkvfnlalrfvkgydlpdevfdene

SCOPe Domain Coordinates for d1fa0b1:

Click to download the PDB-style file with coordinates for d1fa0b1.
(The format of our PDB-style files is described here.)

Timeline for d1fa0b1: