Lineage for d1f8ra1 (1f8r A:4-319,A:433-486)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457696Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2457758Protein L-aminoacid oxidase [51929] (2 species)
  7. 2457764Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (3 PDB entries)
  8. 2457769Domain d1f8ra1: 1f8r A:4-319,A:433-486 [30410]
    Other proteins in same PDB: d1f8ra2, d1f8rb2, d1f8rc2, d1f8rd2
    complexed with cit, fad, nag

Details for d1f8ra1

PDB Entry: 1f8r (more details), 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma complexed with citrate
PDB Compounds: (A:) l-amino acid oxidase

SCOPe Domain Sequences for d1f8ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8ra1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
fnppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglr
aardvnlasen

SCOPe Domain Coordinates for d1f8ra1:

Click to download the PDB-style file with coordinates for d1f8ra1.
(The format of our PDB-style files is described here.)

Timeline for d1f8ra1: