Lineage for d1f8ga2 (1f8g A:1-143,A:327-384)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116681Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2116745Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 2116751Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. 2116752Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)
  8. 2116757Domain d1f8ga2: 1f8g A:1-143,A:327-384 [59696]
    Other proteins in same PDB: d1f8ga1, d1f8gb1, d1f8gc1, d1f8gd1
    complexed with nad

Details for d1f8ga2

PDB Entry: 1f8g (more details), 2 Å

PDB Description: the x-ray structure of nicotinamide nucleotide transhydrogenase from rhodospirillum rubrum complexed with nad+
PDB Compounds: (A:) nicotinamide nucleotide transhydrogenase

SCOPe Domain Sequences for d1f8ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8ga2 c.23.12.2 (A:1-143,A:327-384) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpaltgqga

SCOPe Domain Coordinates for d1f8ga2:

Click to download the PDB-style file with coordinates for d1f8ga2.
(The format of our PDB-style files is described here.)

Timeline for d1f8ga2: