Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species) L-alanine dehydrogenase homologue |
Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries) |
Domain d1f8ga1: 1f8g A:144-326 [59695] Other proteins in same PDB: d1f8ga2, d1f8gb2, d1f8gc2, d1f8gd2 complexed with nad |
PDB Entry: 1f8g (more details), 2 Å
SCOPe Domain Sequences for d1f8ga1:
Sequence, based on SEQRES records: (download)
>d1f8ga1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv psr
>d1f8ga1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv raatkeqveslggkfitvddeataetaggyakemgeefrkkqaeavlkelvktdiaitta lipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvps r
Timeline for d1f8ga1: