Lineage for d1f8ga1 (1f8g A:144-326)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 977277Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 977306Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
    L-alanine dehydrogenase homologue
  7. 977307Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries)
  8. 977312Domain d1f8ga1: 1f8g A:144-326 [59695]
    Other proteins in same PDB: d1f8ga2, d1f8gb2, d1f8gc2, d1f8gd2
    complexed with nad

Details for d1f8ga1

PDB Entry: 1f8g (more details), 2 Å

PDB Description: the x-ray structure of nicotinamide nucleotide transhydrogenase from rhodospirillum rubrum complexed with nad+
PDB Compounds: (A:) nicotinamide nucleotide transhydrogenase

SCOPe Domain Sequences for d1f8ga1:

Sequence, based on SEQRES records: (download)

>d1f8ga1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records): (download)

>d1f8ga1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeataetaggyakemgeefrkkqaeavlkelvktdiaitta
lipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvps
r

SCOPe Domain Coordinates for d1f8ga1:

Click to download the PDB-style file with coordinates for d1f8ga1.
(The format of our PDB-style files is described here.)

Timeline for d1f8ga1: