Lineage for d1f81a_ (1f81 A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707522Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 1707523Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
    automatically mapped to Pfam PF02135
  5. 1707524Family g.53.1.1: TAZ domain [57934] (2 proteins)
  6. 1707525Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)
  7. 1707530Species Mouse (Mus musculus) [TaxId:10090] [57936] (6 PDB entries)
  8. 1707531Domain d1f81a_: 1f81 A: [45383]
    TAZ2 domain (also CH3 domain)
    complexed with zn

Details for d1f81a_

PDB Entry: 1f81 (more details)

PDB Description: solution structure of the taz2 domain of the transcriptional adaptor protein cbp
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d1f81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f81a_ g.53.1.1 (A:) CREB-binding transcriptional adaptor protein CBP (p300) {Mouse (Mus musculus) [TaxId: 10090]}
spqesrrlsiqrciqslvhacqcrnancslpscqkmkrvvqhtkgckrktnggcpvckql
ialccyhakhcqenkcpvpfclnikhk

SCOPe Domain Coordinates for d1f81a_:

Click to download the PDB-style file with coordinates for d1f81a_.
(The format of our PDB-style files is described here.)

Timeline for d1f81a_: