Lineage for d1f6ba_ (1f6b A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (78 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein SAR1 [69483] (3 species) Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [69484] (2 PDB entries) 
Domain d1f6ba_: 1f6b A: [64986]
Details for d1f6ba_
PDB Entry: 1f6b (more details), 1.7 Å
PDB Description: crystal structure of sar1-gdp complex
PDB Compounds: (A:) sar1SCOP Domain Sequences for d1f6ba_:
Sequence, based on SEQRES records: (download)
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtft
tfdlgghiqarrvwknylpaingivflvdcadherlleskeeldslmtdetianvpilil
gnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrw
maqyid
Sequence, based on observed residues (ATOM records): (download)
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkddptlhptseeltiagmtfttfdlgg
rrvwknylpaingivflvdcadherlleskeeldslmtdetianvpililgnkidrpeai
seerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid
SCOP Domain Coordinates for d1f6ba_:
Click to download the PDB-style file with coordinates for d1f6ba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f6ba_:
- d1f6ba_ first appeared in SCOP 1.59
- d1f6ba_ appears in SCOP 1.73
- d1f6ba_ appears in SCOPe 2.01
- d1f6ba_ appears in the current release, SCOPe 2.08
View in 3D
