Lineage for d1f60a2 (1f60 A:335-441)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793866Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2793867Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2793868Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (6 PDB entries)
  8. 2793871Domain d1f60a2: 1f60 A:335-441 [25745]
    Other proteins in same PDB: d1f60a1, d1f60a3, d1f60b_

Details for d1f60a2

PDB Entry: 1f60 (more details), 1.67 Å

PDB Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba
PDB Compounds: (A:) elongation factor eef1a

SCOPe Domain Sequences for d1f60a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk

SCOPe Domain Coordinates for d1f60a2:

Click to download the PDB-style file with coordinates for d1f60a2.
(The format of our PDB-style files is described here.)

Timeline for d1f60a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f60b_