Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.4: Phosphoserine phosphatase [64511] (1 protein) the insertion subdomain is a 4-helical bundle automatically mapped to Pfam PF06888 automatically mapped to Pfam PF12710 |
Protein Phosphoserine phosphatase [64512] (2 species) |
Species Methanococcus jannaschii [TaxId:2190] [64513] (6 PDB entries) |
Domain d1f5sa_: 1f5s A: [59656] complexed with mg, po4 |
PDB Entry: 1f5s (more details), 1.8 Å
SCOPe Domain Sequences for d1f5sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5sa_ c.108.1.4 (A:) Phosphoserine phosphatase {Methanococcus jannaschii [TaxId: 2190]} ekkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllk dlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafan rlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglk iafcakpilkekadiciekrdlreilkyik
Timeline for d1f5sa_: