Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.1: GAF domain [55782] (8 proteins) |
Protein Hypothetical protein ykl069wp [55783] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55784] (2 PDB entries) |
Domain d1f5mb_: 1f5m B: [40896] structural genomics complexed with br |
PDB Entry: 1f5m (more details), 1.9 Å
SCOPe Domain Sequences for d1f5mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5mb_ d.110.2.1 (B:) Hypothetical protein ykl069wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sstgfhhadhvnyssnlnkeeileqlllsyeglsdgqvnwvcnlsnassliwhaykslav dinwagfyvtqaseentlilgpfqgkvacqmiqfgkgvcgtaastketqivpdvnkypgh iacdgetkseivvpiisndgktlgvididcldyegfdhvdkefleklaklinkscvf
Timeline for d1f5mb_: