Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) automatically mapped to Pfam PF03951 |
Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries) |
Domain d1f52a1: 1f52 A:1-100 [37839] Other proteins in same PDB: d1f52a2, d1f52b2, d1f52c2, d1f52d2, d1f52e2, d1f52f2, d1f52g2, d1f52h2, d1f52i2, d1f52j2, d1f52k2, d1f52l2 complexed with adp, mn, mpd |
PDB Entry: 1f52 (more details), 2.49 Å
SCOPe Domain Sequences for d1f52a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f52a1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
Timeline for d1f52a1: