Lineage for d1f47b_ (1f47 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582712Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
    automatically mapped to Pfam PF04354
  5. 2582713Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)
  6. 2582714Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 2582715Species Escherichia coli [TaxId:562] [64386] (6 PDB entries)
  8. 2582718Domain d1f47b_: 1f47 B: [59645]
    complexed with an FtsZ fragment

Details for d1f47b_

PDB Entry: 1f47 (more details), 1.95 Å

PDB Description: the bacterial cell-division protein zipa and its interaction with an ftsz fragment revealed by x-ray crystallography
PDB Compounds: (B:) cell division protein zipa

SCOPe Domain Sequences for d1f47b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f47b_ d.129.4.1 (B:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
rrmmtpqklreyqdiirevkdana

SCOPe Domain Coordinates for d1f47b_:

Click to download the PDB-style file with coordinates for d1f47b_.
(The format of our PDB-style files is described here.)

Timeline for d1f47b_: