Lineage for d1f47b_ (1f47 B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733637Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
  5. 733638Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein)
  6. 733639Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 733640Species Escherichia coli [TaxId:562] [64386] (8 PDB entries)
  8. 733643Domain d1f47b_: 1f47 B: [59645]
    complexed with an FtsZ fragment

Details for d1f47b_

PDB Entry: 1f47 (more details), 1.95 Å

PDB Description: the bacterial cell-division protein zipa and its interaction with an ftsz fragment revealed by x-ray crystallography
PDB Compounds: (B:) cell division protein zipa

SCOP Domain Sequences for d1f47b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f47b_ d.129.4.1 (B:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
rrmmtpqklreyqdiirevkdana

SCOP Domain Coordinates for d1f47b_:

Click to download the PDB-style file with coordinates for d1f47b_.
(The format of our PDB-style files is described here.)

Timeline for d1f47b_: