Lineage for d1f44a2 (1f44 A:130-343)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
core: alpha3-beta3-alpha4; one side of beta-sheet is exposedSuperfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) 
Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins) 
Protein Cre recombinase [56355] (1 species) Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
Uniprot P06956 20-341
Domain d1f44a2: 1f44 A:130-343 [64983]
Other proteins in same PDB: d1f44a1
protein/DNA complex
Details for d1f44a2
PDB Entry: 1f44 (more details), 2.05 Å
PDB Description: crystal structure of trimeric cre recombinase-lox complex
PDB Compounds: (A:) cre recombinaseSCOPe Domain Sequences for d1f44a2:
Sequence, based on SEQRES records: (download)
>d1f44a2 d.163.1.1 (A:130-343) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnfirnldsetgamvrlledgd
Sequence, based on observed residues (ATOM records): (download)
>d1f44a2 d.163.1.1 (A:130-343) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrgvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqls
tralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtn
vnivmnfirnldsetgamvrlledgd
SCOPe Domain Coordinates for d1f44a2:
Click to download the PDB-style file with coordinates for d1f44a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f44a2:
- d1f44a2 first appeared in SCOP 1.59
- d1f44a2 appears in SCOPe 2.07
View in 3D
