Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein MJ0796 [64027] (1 species) |
Species Methanococcus jannaschii [TaxId:2190] [64028] (2 PDB entries) |
Domain d1f3oa_: 1f3o A: [59631] complexed with adp, mg |
PDB Entry: 1f3o (more details), 2.7 Å
SCOPe Domain Sequences for d1f3oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3oa_ c.37.1.12 (A:) MJ0796 {Methanococcus jannaschii [TaxId: 2190]} miklknvtktykmgeeiiyalknvnlnikegefvsimgpsgsgkstmlniigcldkpteg evyidniktndldddeltkirrdkigfvfqqfnliplltalenvelplifkyrgamsgee rrkraleclkmaeleerfanhkpnqlsggqqqrvaiaralannppiiladeptgaldskt gekimqllkklneedgktvvvvthdinvarfgeriiylkdgevereeklrgf
Timeline for d1f3oa_: