Lineage for d1f3oa_ (1f3o A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1365100Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1365263Protein MJ0796 [64027] (1 species)
  7. 1365264Species Methanococcus jannaschii [TaxId:2190] [64028] (2 PDB entries)
  8. 1365267Domain d1f3oa_: 1f3o A: [59631]
    complexed with adp, mg

Details for d1f3oa_

PDB Entry: 1f3o (more details), 2.7 Å

PDB Description: crystal structure of mj0796 atp-binding cassette
PDB Compounds: (A:) hypothetical abc transporter ATP-binding protein mj0796

SCOPe Domain Sequences for d1f3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3oa_ c.37.1.12 (A:) MJ0796 {Methanococcus jannaschii [TaxId: 2190]}
miklknvtktykmgeeiiyalknvnlnikegefvsimgpsgsgkstmlniigcldkpteg
evyidniktndldddeltkirrdkigfvfqqfnliplltalenvelplifkyrgamsgee
rrkraleclkmaeleerfanhkpnqlsggqqqrvaiaralannppiiladeptgaldskt
gekimqllkklneedgktvvvvthdinvarfgeriiylkdgevereeklrgf

SCOPe Domain Coordinates for d1f3oa_:

Click to download the PDB-style file with coordinates for d1f3oa_.
(The format of our PDB-style files is described here.)

Timeline for d1f3oa_: