| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class alpha GST [81360] (8 species) |
| Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [52872] (2 PDB entries) |
| Domain d1f3ba2: 1f3b A:1-79 [32993] Other proteins in same PDB: d1f3ba1, d1f3bb1 complexed with gbx |
PDB Entry: 1f3b (more details), 2 Å
SCOPe Domain Sequences for d1f3ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3ba2 c.47.1.5 (A:1-79) Class alpha GST {Mouse (Mus musculus), (a1-1) [TaxId: 10090]}
agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatkyd
Timeline for d1f3ba2: