Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
Protein Transglutaminase catalytic domain [54045] (4 species) |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (9 PDB entries) Coagulation factor XIII |
Domain d1f13a4: 1f13 A:191-515 [37107] Other proteins in same PDB: d1f13a1, d1f13a2, d1f13a3, d1f13b1, d1f13b2, d1f13b3 |
PDB Entry: 1f13 (more details), 2.1 Å
SCOPe Domain Sequences for d1f13a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f13a4 d.3.1.4 (A:191-515) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]} davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee rlaletalmygakkplntegvmksr
Timeline for d1f13a4:
View in 3D Domains from other chains: (mouse over for more information) d1f13b1, d1f13b2, d1f13b3, d1f13b4 |