![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Protein kinase CK2, alpha subunit [56142] (3 species) CMGC group; CK2 subfamily; serine/threonine kinase |
![]() | Species Maize (Zea mays) [TaxId:4577] [56143] (33 PDB entries) |
![]() | Domain d1f0qa_: 1f0q A: [59568] complexed with emo |
PDB Entry: 1f0q (more details), 2.63 Å
SCOPe Domain Sequences for d1f0qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f0qa_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]} mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll rydhqerltaleamthpyfqqvraaensr
Timeline for d1f0qa_: