Lineage for d1f0jb_ (1f0j B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) 
Family a.211.1.2: PDEase [48548] (7 proteins)
Pfam PF00233; multihelical; can be divided into three subdomains
Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries)
Uniprot Q07343 324-667
Domain d1f0jb_: 1f0j B: [19347]
complexed with ars, mg, zn
Details for d1f0jb_
PDB Entry: 1f0j (more details), 1.77 Å
PDB Description: catalytic domain of human phosphodiesterase 4b2b
PDB Compounds: (B:) phosphodiesterase 4bSCOPe Domain Sequences for d1f0jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f0jb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqsmipqap
SCOPe Domain Coordinates for d1f0jb_:
Click to download the PDB-style file with coordinates for d1f0jb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f0jb_:
- d1f0jb_ first appeared (with stable ids) in SCOP 1.55
- d1f0jb_ appears in SCOPe 2.07
View in 3D
