Lineage for d1f00i3 (1f00 I:842-939)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682586Family d.169.1.3: Invasin/intimin cell-adhesion fragment, C-terminal domain [56472] (2 proteins)
    automatically mapped to Pfam PF07979
  6. 1682587Protein Intimin [56473] (1 species)
  7. 1682588Species Escherichia coli [TaxId:562] [56474] (3 PDB entries)
    an enteropathogenic serotype
  8. 1682589Domain d1f00i3: 1f00 I:842-939 [42439]
    Other proteins in same PDB: d1f00i1, d1f00i2

Details for d1f00i3

PDB Entry: 1f00 (more details), 1.9 Å

PDB Description: crystal structure of c-terminal 282-residue fragment of enteropathogenic e. coli intimin
PDB Compounds: (I:) intimin

SCOPe Domain Sequences for d1f00i3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f00i3 d.169.1.3 (I:842-939) Intimin {Escherichia coli [TaxId: 562]}
livpnmskrvtyndavntcknfggklpssqnelenvfkawgaankyeyykssqtiiswvq
qtaqdaksgvastydlvkqnplnnikasesnayatcvk

SCOPe Domain Coordinates for d1f00i3:

Click to download the PDB-style file with coordinates for d1f00i3.
(The format of our PDB-style files is described here.)

Timeline for d1f00i3: