Lineage for d1ezma_ (1ezm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963595Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2963599Protein Elastase [63413] (1 species)
  7. 2963600Species Pseudomonas aeruginosa [TaxId:287] [55492] (6 PDB entries)
    Uniprot P14756 198-495
  8. 2963603Domain d1ezma_: 1ezm A: [58980]
    complexed with ca, zn

Details for d1ezma_

PDB Entry: 1ezm (more details), 1.5 Å

PDB Description: three-dimensional structure of the elastase of pseudomonas aeruginosa at 1.5 angstroms resolution
PDB Compounds: (A:) pseudomonas elastase

SCOPe Domain Sequences for d1ezma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezma_ d.92.1.2 (A:) Elastase {Pseudomonas aeruginosa [TaxId: 287]}
aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcp

SCOPe Domain Coordinates for d1ezma_:

Click to download the PDB-style file with coordinates for d1ezma_.
(The format of our PDB-style files is described here.)

Timeline for d1ezma_: