Lineage for d1eyta_ (1eyt A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035083Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 3035084Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 3035085Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 3035086Protein HIPIP (high potential iron protein) [57654] (9 species)
  7. 3035122Species Thermochromatium tepidum [TaxId:1050] [57660] (11 PDB entries)
  8. 3035132Domain d1eyta_: 1eyt A: [44996]
    complexed with sf4

Details for d1eyta_

PDB Entry: 1eyt (more details), 1.5 Å

PDB Description: crystal structure of high-potential iron-sulfur protein from thermochromatium tepidum
PDB Compounds: (A:) high-potential iron-sulfur protein

SCOPe Domain Sequences for d1eyta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyta_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum [TaxId: 1050]}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag

SCOPe Domain Coordinates for d1eyta_:

Click to download the PDB-style file with coordinates for d1eyta_.
(The format of our PDB-style files is described here.)

Timeline for d1eyta_: