Class a: All alpha proteins [46456] (290 folds) |
Fold a.79: NusB-like [48012] (1 superfamily) 6 helices: bundle; one central helix is surrounded by 5 others |
Superfamily a.79.1: NusB-like [48013] (4 families) |
Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins) automatically mapped to Pfam PF01029 |
Protein Antitermination factor NusB [48015] (3 species) |
Species Escherichia coli [TaxId:562] [48017] (2 PDB entries) |
Domain d1ey1a_: 1ey1 A: [18449] |
PDB Entry: 1ey1 (more details)
SCOPe Domain Sequences for d1ey1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ey1a_ a.79.1.1 (A:) Antitermination factor NusB {Escherichia coli [TaxId: 562]} mkpaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatnta yldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedsh kfvngvldkaapvirpnkk
Timeline for d1ey1a_: