Lineage for d1exqa_ (1exq A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (18 families) 
consists of one domain of this fold
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
Pfam PF00665Protein Retroviral integrase, catalytic domain [53108] (5 species) 
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries) 
Domain d1exqa_: 1exq A: [33646]
complexed with cd, cl, so4
Details for d1exqa_
PDB Entry: 1exq (more details), 1.6 Å
PDB Description: crystal structure of the hiv-1 integrase catalytic core domain
PDB Compounds: (A:) Pol polyproteinSCOPe Domain Sequences for d1exqa_:
Sequence, based on SEQRES records: (download)
>d1exqa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq
Sequence, based on observed residues (ATOM records): (download)
>d1exqa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipyvesmnkelkkiigqvrdqaehlktavqmavfi
hnkkrkggiggysagerivdiiatdiq
SCOPe Domain Coordinates for d1exqa_:
Click to download the PDB-style file with coordinates for d1exqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1exqa_:
- d1exqa_ first appeared (with stable ids) in SCOP 1.55
- d1exqa_ appears in SCOPe 2.07
View in 3D
