![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (4 families) ![]() |
![]() | Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
![]() | Protein T5 5'-exonuclease [53050] (1 species) |
![]() | Species Bacteriophage T5 [TaxId:10726] [53051] (6 PDB entries) |
![]() | Domain d1exna2: 1exn A:20-185 [33358] Other proteins in same PDB: d1exna1, d1exnb1 |
PDB Entry: 1exn (more details), 2.5 Å
SCOPe Domain Sequences for d1exna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exna2 c.120.1.2 (A:20-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhn
Timeline for d1exna2: