Lineage for d1ex4b2 (1ex4 B:55-222)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (16 families) 
consists of one domain of this fold
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Protein Retroviral integrase, catalytic domain [53108] (4 species) 
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries) 
Domain d1ex4b2: 1ex4 B:55-222 [33671]
Other proteins in same PDB: d1ex4a1, d1ex4b1
complexed with cps
Details for d1ex4b2
PDB Entry: 1ex4 (more details), 2.8 Å
PDB Description: hiv-1 integrase catalytic core and c-terminal domain
PDB Compounds: (B:) integraseSCOPe Domain Sequences for d1ex4b2:
Sequence, based on SEQRES records: (download)
>d1ex4b2 c.55.3.2 (B:55-222) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
dsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktih
tdngsnftgatvraacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkt
avqmavfihnkkrkggiggysagerivdiiatdiqtkelqkqitkiqn
Sequence, based on observed residues (ATOM records): (download)
>d1ex4b2 c.55.3.2 (B:55-222) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
dsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktih
tdngsnftgatvraacdwagikqvvesmnkelkkiigqvrdqaehlktavqmavfihnkk
rkggiggysagerivdiiatdiqtkelqkqitkiqn
SCOPe Domain Coordinates for d1ex4b2:
Click to download the PDB-style file with coordinates for d1ex4b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ex4b2:
View in 3D
