| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
| Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
| Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
| Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (9 PDB entries) Coagulation factor XIII, |
| Domain d1ex0a3: 1ex0 A:628-727 [90467] Other proteins in same PDB: d1ex0a1, d1ex0a4, d1ex0b1, d1ex0b4 complexed with ca, pgo, po4; mutant |
PDB Entry: 1ex0 (more details), 2 Å
SCOPe Domain Sequences for d1ex0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ex0a3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
tipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
Timeline for d1ex0a3:
View in 3DDomains from other chains: (mouse over for more information) d1ex0b1, d1ex0b2, d1ex0b3, d1ex0b4 |