Lineage for d1ewya2 (1ewy A:142-303)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) 
binds NADP differently than classical Rossmann-fold
N-terminal FAD-linked domain contains (6,10) barrelFamily c.25.1.1: Reductases [52344] (5 proteins) 
Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species) - Species Anabaena sp., pcc 7119 [TaxId:1167] [52350] (19 PDB entries)
Domain d1ewya2: 1ewy A:142-303 [31541]
Other proteins in same PDB: d1ewya1, d1ewyb1, d1ewyc_
complexed with fad, fes
Details for d1ewya2
PDB Entry: 1ewy (more details), 2.38 Å
PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
PDB Compounds: (A:) ferredoxin-nadp reductaseSCOPe Domain Sequences for d1ewya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewya2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Anabaena sp., pcc 7119 [TaxId: 1167]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety
SCOPe Domain Coordinates for d1ewya2:
Click to download the PDB-style file with coordinates for d1ewya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ewya2:
- d1ewya2 first appeared (with stable ids) in SCOP 1.55
- d1ewya2 appears in SCOPe 2.03
- d1ewya2 appears in SCOPe 2.05
- d1ewya2 appears in the current release, SCOPe 2.08
View in 3D
