Lineage for d1ewia_ (1ewi A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668156Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species)
    duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511
  7. 668157Species Human (Homo sapiens) [TaxId:9606] [50268] (6 PDB entries)
  8. 668168Domain d1ewia_: 1ewi A: [25302]
    N-terminal domain only

Details for d1ewia_

PDB Entry: 1ewi (more details)

PDB Description: human replication protein a: global fold of the n-terminal rpa-70 domain reveals a basic cleft and flexible c-terminal linker
PDB Compounds: (A:) replication protein a

SCOP Domain Sequences for d1ewia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewia_ b.40.4.3 (A:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkign

SCOP Domain Coordinates for d1ewia_:

Click to download the PDB-style file with coordinates for d1ewia_.
(The format of our PDB-style files is described here.)

Timeline for d1ewia_: