Lineage for d1ewfa2 (1ewf A:218-456)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies)
core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meanderSuperfamily d.83.1: Bactericidal permeability-increasing protein, BPI [55394] (2 families) 
duplication: consists of two clear structural repeats of this fold also containing an extra C-terminal beta-hairpinFamily d.83.1.1: Bactericidal permeability-increasing protein, BPI [55395] (1 protein) Protein Bactericidal permeability-increasing protein, BPI [55396] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55397] (2 PDB entries) 
Domain d1ewfa2: 1ewf A:218-456 [40025]
complexed with pc1
Details for d1ewfa2
PDB Entry: 1ewf (more details), 1.7 Å
PDB Description: the 1.7 angstrom crystal structure of bpi
PDB Compounds: (A:) bactericidal/permeability-increasing proteinSCOPe Domain Sequences for d1ewfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewfa2 d.83.1.1 (A:218-456) Bactericidal permeability-increasing protein, BPI {Human (Homo sapiens) [TaxId: 9606]}
etldvqmkgefysenhhnpppfappvmefpaahdrmvylglsdyffntaglvyqeagvlk
mtlrddmipkeskfrlttkffgtflpevakkfpnmkiqihvsastpphlsvqptgltfyp
avdvqafavlpnsalaslfligmhttgsmevsaesnrlvgelkldrlllelkhsnigpfp
vellqdimnyivpilvlprvneklqkgfplptparvqlynvvlqphqnfllfgadvvyk
SCOPe Domain Coordinates for d1ewfa2:
Click to download the PDB-style file with coordinates for d1ewfa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ewfa2:
- d1ewfa2 first appeared (with stable ids) in SCOP 1.55
- d1ewfa2 appears in SCOPe 2.07
View in 3D
