Lineage for d1evua1 (1evu A:1-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765693Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2765694Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2765695Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (9 PDB entries)
    Coagulation factor XIII
  8. 2765698Domain d1evua1: 1evu A:1-190 [21883]
    Other proteins in same PDB: d1evua2, d1evua3, d1evua4, d1evub2, d1evub3, d1evub4
    complexed with ca, pgo

Details for d1evua1

PDB Entry: 1evu (more details), 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site
PDB Compounds: (A:) coagulation factor xiii

SCOPe Domain Sequences for d1evua1:

Sequence, based on SEQRES records: (download)

>d1evua1 b.1.18.9 (A:1-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
yilfnpwced

Sequence, based on observed residues (ATOM records): (download)

>d1evua1 b.1.18.9 (A:1-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
setsrtafggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyenn
klivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwga
kivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced

SCOPe Domain Coordinates for d1evua1:

Click to download the PDB-style file with coordinates for d1evua1.
(The format of our PDB-style files is described here.)

Timeline for d1evua1: