Lineage for d1evqa_ (1evq A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1382705Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1382706Protein Carboxylesterase [53488] (3 species)
    bacterial homologue of human hormone sensitive lipase
  7. 1382707Species Alicyclobacillus acidocaldarius [TaxId:405212] [53490] (4 PDB entries)
    Uniprot Q7SIG1
  8. 1382711Domain d1evqa_: 1evq A: [34635]
    complexed with epe, trs

Details for d1evqa_

PDB Entry: 1evq (more details), 2.6 Å

PDB Description: the crystal structure of the thermophilic carboxylesterase est2 from alicyclobacillus acidocaldarius
PDB Compounds: (A:) serine hydrolase

SCOPe Domain Sequences for d1evqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evqa_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtlkv
rmyrpegveppypalvyyhgggwvvgdlethdpvcrvlakdgravvfsvdyrlapehkfp
aavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafqlli
ypstgydpahppasieenaegylltggmmlwfrdqylnsleelthpwfspvlypdlsglp
payiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvria
eklrdala

SCOPe Domain Coordinates for d1evqa_:

Click to download the PDB-style file with coordinates for d1evqa_.
(The format of our PDB-style files is described here.)

Timeline for d1evqa_: