Lineage for d1euvb_ (1euv B:)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (7 families) 
Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
Pfam PF00240
Protein SUMO-1 (smt3 homologue) [54241] (2 species) 
Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (3 PDB entries) 
Domain d1euvb_: 1euv B: [37598]
Other proteins in same PDB: d1euva_
Details for d1euvb_
PDB Entry: 1euv (more details), 1.6 Å
PDB Description: x-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.
PDB Compounds: (B:) ubitqutin-like protein smt3SCOP Domain Sequences for d1euvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
dldmedndiieahreqigg
SCOP Domain Coordinates for d1euvb_:
Click to download the PDB-style file with coordinates for d1euvb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1euvb_:
- d1euvb_ first appeared (with stable ids) in SCOP 1.55
- d1euvb_ appears in SCOP 1.71
- d1euvb_ appears in SCOP 1.75
- d1euvb_ appears in the current release, SCOPe 2.08
View in 3D
