Lineage for d1eut_1 (1eut 403-505)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (18 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
domains of unknown function associated with different type of catalytic domains in a different sequential location
subgroup of the larger IPT/TIG domain family
Protein Sialidase, "linker" domain [49237] (1 species)
follows the catalytic six-bladed beta-propeller domainSpecies Micromonospora viridifaciens [TaxId:1881] [49238] (4 PDB entries) 
Domain d1eut_1: 1eut 403-505 [21891]
Other proteins in same PDB: d1eut_2, d1eut_3
complexed with na
Details for d1eut_1
PDB Entry: 1eut (more details), 2.5 Å
PDB Description: sialidase, large 68kd form, complexed with galactose
SCOP Domain Sequences for d1eut_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eut_1 b.1.18.2 (403-505) Sialidase, "linker" domain {Micromonospora viridifaciens}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld
SCOP Domain Coordinates for d1eut_1:
Click to download the PDB-style file with coordinates for d1eut_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eut_1:
- d1eut_1 first appeared (with stable ids) in SCOP 1.55
- d1eut_1 appears in SCOP 1.69
- d1eut_1 is called d1euta1 in SCOP 1.73
- d1eut_1 appears in the current release, SCOPe 2.08, called d1euta1
View in 3D
