Lineage for d1eu8a_ (1eu8 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162128Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 2162235Species Thermococcus litoralis [TaxId:2265] [64191] (1 PDB entry)
    trehalose maltose-binding protein
  8. 2162236Domain d1eu8a_: 1eu8 A: [59502]
    complexed with cl, pt, tre

Details for d1eu8a_

PDB Entry: 1eu8 (more details), 1.9 Å

PDB Description: structure of trehalose maltose binding protein from thermococcus litoralis
PDB Compounds: (A:) trehalose/maltose binding protein

SCOPe Domain Sequences for d1eu8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Thermococcus litoralis [TaxId: 2265]}
ieegkivfavggapneieywkgviaefekkypgvtvelkrqatdteqrrldlvnalrgks
sdpdvflmdvawlgqfiasgwleplddyvqkdnydlsvffqsvinladkqggklyalpvy
idagllyyrkdllekygyskppetwqelvemaqkiqsgeretnpnfwgfvwqgkqyeglv
cdfveyvysnggslgefkdgkwvptlnkpenvealqfmvdlihkykisppntytemteep
vrlmfqqgnaafernwpyawglhnaddspvkgkvgvaplphfpghksaatlggwhigisk
ysdnkalawefvkfvesysvqkgfamnlgwnpgrvdvyddpavvsksphlkelravfena
vprpivpyypqlseiiqkyvnsalagkispqealdkaqkeaeelvkq

SCOPe Domain Coordinates for d1eu8a_:

Click to download the PDB-style file with coordinates for d1eu8a_.
(The format of our PDB-style files is described here.)

Timeline for d1eu8a_: