Lineage for d1esma_ (1esm A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474782Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. 2474789Protein Pantothenate kinase PanK [52587] (1 species)
    has a circularly permuted fold compared to the phosphoribulokinase fold
  7. 2474790Species Escherichia coli [TaxId:562] [52588] (3 PDB entries)
    Uniprot P15044
  8. 2474795Domain d1esma_: 1esm A: [31953]
    complexed with coa

Details for d1esma_

PDB Entry: 1esm (more details), 2.5 Å

PDB Description: structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d1esma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esma_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}
qtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfy
issnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelit
tdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipd
gdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrfl
kfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksa
nhaveevrlrk

SCOPe Domain Coordinates for d1esma_:

Click to download the PDB-style file with coordinates for d1esma_.
(The format of our PDB-style files is described here.)

Timeline for d1esma_: