Lineage for d1esfa2 (1esf A:121-233)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Staphylococcal enterotoxin A, SEA [54336] (1 species) Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries) 
Domain d1esfa2: 1esf A:121-233 [37735]
Other proteins in same PDB: d1esfa1, d1esfb1
complexed with cd
Details for d1esfa2
PDB Entry: 1esf (more details), 1.9 Å
PDB Description: staphylococcal enterotoxin a
PDB Compounds: (A:) staphylococcal enterotoxin aSCOPe Domain Sequences for d1esfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esfa2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
SCOPe Domain Coordinates for d1esfa2:
Click to download the PDB-style file with coordinates for d1esfa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1esfa2:
- d1esfa2 first appeared (with stable ids) in SCOP 1.55
- d1esfa2 appears in SCOPe 2.04
- d1esfa2 appears in SCOPe 2.06
- d1esfa2 appears in the current release, SCOPe 2.08
View in 3D
